FBXO34 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO34

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: F-box only protein 34

Protein Size: 711

Purification: Affinity Purified

• SKU: AVIARP57071_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57071_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55030
• Host: Rabbit