FBXW4 Antibody - N-terminal region : HRP

FBXW4 Antibody - N-terminal region : HRP
SKU
AVIARP57577_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a member of the F-box/WD-40 gene family, which recruit specific target proteins through their WD-40 protein-protein binding domains for ubiquitin mediated degradation. In mouse, a highly similar protein is thought to be responsible for maintaining the apical ectodermal ridge of developing limb buds; disruption of the mouse gene results in the absence of central digits, underdeveloped or absent metacarpal/metatarsal bones and syndactyly. This phenotype is remarkably similar to split hand-split foot malformation in humans, a clinically heterogeneous condition with a variety of modes of transmission. An autosomal recessive form has been mapped to the chromosomal region where this gene is located, and complex rearrangements involving duplications of this gene and others have been associated with the condition. A pseudogene of this locus has been mapped to one of the introns of the BCR gene on chromosome 22.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human FBXW4

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: RQMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: F-box/WD repeat-containing protein 4

Protein Size: 325

Purification: Affinity Purified
More Information
SKU AVIARP57577_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57577_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6468
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×