FCN1 Antibody - middle region : Biotin

FCN1 Antibody - middle region : Biotin
SKU
AVIARP54606_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FCN1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: HQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDND

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ficolin-1

Protein Size: 326

Purification: Affinity Purified
More Information
SKU AVIARP54606_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54606_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2219
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×