FDXR Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: DHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NADPH:adrenodoxin oxidoreductase, mitochondrial

Protein Size: 491

Purification: Affinity Purified

• SKU: AVIARP54706_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54706_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2232
• Host: Rabbit