FES Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis. This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis. A truncated transcript has been identified that is generated utilizing a start site in one of the far downstream exons but a protein product associated with this transcript has not been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FES

Key Reference: Naba,A., (2008) EMBO J. 27 (1), 38-50

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tyrosine-protein kinase Fes/Fps

Protein Size: 822

Purification: Affinity Purified

• SKU: AVIARP54608_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54608_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2242
• Host: Rabbit