FEV Antibody - N-terminal region : FITC

FEV Antibody - N-terminal region : FITC
SKU
AVIARP57889_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repressor. This gene is exclusively expressed in neurons of the central serotonin (5-HT) system, a system implicated in the pathogeny of such psychiatric diseases as depression, anxiety, and eating disorders. In some types of Ewing tumors, this gene is fused to the Ewing sarcoma (EWS) gene following chromosome translocations.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FEV

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FEV

Protein Size: 238

Purification: Affinity Purified
More Information
SKU AVIARP57889_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57889_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54738
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×