FGF11 Antibody - N-terminal region : Biotin

FGF11 Antibody - N-terminal region : Biotin
SKU
AVIARP54709_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGF11

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor 11

Protein Size: 225

Purification: Affinity Purified
More Information
SKU AVIARP54709_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54709_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2256
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×