FGF21 Antibody - N-terminal region : Biotin

FGF21 Antibody - N-terminal region : Biotin
SKU
AVIARP55368_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGF21

Key Reference: Chen,W.W., (2008) Exp. Clin. Endocrinol. Diabetes 116 (1), 65-68

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor 21

Protein Size: 209

Purification: Affinity Purified
More Information
SKU AVIARP55368_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55368_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 26291
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×