FKBP5 Antibody - C-terminal region : HRP

FKBP5 Antibody - C-terminal region : HRP
SKU
AVIARP54713_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP5

Key Reference: Lekman,M., (2008) Biol. Psychiatry 63 (12), 1103-1110

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP5

Protein Size: 457

Purification: Affinity Purified
More Information
SKU AVIARP54713_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54713_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 2289
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×