FKBPL Antibody - N-terminal region : Biotin

FKBPL Antibody - N-terminal region : Biotin
SKU
AVIARP57598_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FKBPL

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FK506-binding protein-like

Protein Size: 349

Purification: Affinity Purified
More Information
SKU AVIARP57598_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57598_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63943
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×