FLII Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLII

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 145kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein flightless-1 homolog

Protein Size: 1269

Purification: Affinity Purified

• SKU: AVIARP54614_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54614_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2314
• Host: Rabbit