FLJ33790 Antibody - N-terminal region : Biotin

FLJ33790 Antibody - N-terminal region : Biotin
SKU
AVIARP54502_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific functin of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ33790

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kelch-like protein 35

Protein Size: 363

Purification: Affinity Purified
More Information
SKU AVIARP54502_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54502_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283212
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×