FLJ36070 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: FLJ36070 is a transcriptional coactivator.FLJ36070 stimulates the transcriptional activity of MEF2C. FLJ36070 stimulates MYOD1 activity in part via MEF2, resulting in an enhancement of skeletal muscle differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MEF2-activating motif and SAP domain-containing transcriptional regulator

Protein Size: 312

Purification: Affinity Purified

• SKU: AVIARP55828_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55828_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 284358
• Host: Rabbit