FLJ37543 Antibody - middle region : HRP

FLJ37543 Antibody - middle region : HRP
SKU
AVIARP55684_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLJ37543

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C5orf64

Protein Size: 130

Purification: Affinity Purified
More Information
SKU AVIARP55684_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55684_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285668
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×