FN3KRP Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.FN3KRP and FN3K (MIM 608425) protect proteins from nonenzymatic glycation by phosphorylating the modified amino acid. This phosphorylation destabilizes the sugar-amine linkage and leads to spontaneous decomposition (Conner et al., 2004 [PubMed 15381090]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FN3KRP

Key Reference: Szwergold,B., (2007) Biochem. Biophys. Res. Commun. 361 (4), 870-875

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ketosamine-3-kinase

Protein Size: 309

Purification: Affinity Purified

• SKU: AVIARP58624_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58624_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 79672
• Host: Rabbit
• Conjugate: Conjugated, FITC