FNDC8 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of FNDC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FNDC8

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibronectin type III domain-containing protein 8

Protein Size: 324

Purification: Affinity Purified

• SKU: AVIARP56975_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56975_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54752
• Host: Rabbit