Application Note: IHC-P: 5 μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Calculated MW: 60
Form: Liquid
Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium azide.
Concentration: 0.5-1 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008]
Uniprot ID: Q9ULV1
Antigen Species: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV.
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Full Name: frizzled class receptor 4
English
Deutsch
