FRK Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FRK is not yet known.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FRK

Key Reference: Zhang,Y., (2005) Mol. Cell Proteomics 4 (9), 1240-1250

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase FRK

Protein Size: 505

Purification: Affinity Purified

• SKU: AVIARP54617_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54617_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2444
• Host: Rabbit