FRK Antibody - N-terminal region : HRP

FRK Antibody - N-terminal region : HRP
SKU
AVIARP54617_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of FRK is not yet known.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FRK

Key Reference: Zhang,Y., (2005) Mol. Cell Proteomics 4 (9), 1240-1250

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tyrosine-protein kinase FRK

Protein Size: 505

Purification: Affinity Purified
More Information
SKU AVIARP54617_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54617_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2444
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×