FRMD3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a single pass membrane protein primarily found in ovaries. A similar protein in erythrocytes helps determine the shape of red blood cells, but the function of the encoded protein has not been determined. There is some evidence that this is a tumor suppressor gene, and there is also evidence linking defects in this gene to susceptibility to diabetic nephropathy in type 1 diabetes. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN FRMD3

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: GACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: FERM domain-containing protein 3

Protein Size: 553

Purification: Affinity Purified

• SKU: AVIARP55726_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55726_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 257019
• Host: Rabbit