Frs3 Antibody - C-terminal region : FITC

Frs3 Antibody - C-terminal region : FITC
SKU
AVIARP58468_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Frs3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. It is involved in the activation of MAP kinases. Frs3 Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Frs3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: APGPTPHPVRSSDSYAVIDLKKTAAMSDLQRALPRDDGAVRKTRHNSTDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor receptor substrate 3

Protein Size: 492

Purification: Affinity Purified
More Information
SKU AVIARP58468_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58468_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 107971
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×