FTSJD2 Antibody - C-terminal region : HRP

FTSJD2 Antibody - C-terminal region : HRP
SKU
AVIARP55152_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FTSJD2 is a S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. It methylates the ribose of the first nucleotide of a m7GpppG-capped mRNA to produce m7GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. It may be involved in the interferon response pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FTSJD2

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1

Protein Size: 835

Purification: Affinity Purified
More Information
SKU AVIARP55152_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55152_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23070
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×