FYN Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FYN

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tyrosine-protein kinase Fyn

Protein Size: 537

Purification: Affinity Purified

• SKU: AVIARP55568_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55568_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2534
• Host: Rabbit