GABARAPL1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GABARAPL1

Key Reference: Tanida,I., (2006) FEBS J. 273 (11), 2553-2562

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 117

Purification: Affinity Purified

• SKU: AVIARP55399_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55399_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 23710
• Host: Rabbit