GABARAPL1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: GABARAPL1 is a Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. it is involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GABARAPL1

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1

Protein Size: 146

Purification: Affinity Purified

• SKU: AVIARP58901_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58901_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23710
• Host: Rabbit
• Conjugate: Conjugated, HRP