GABPB2 Antibody - N-terminal region : Biotin

GABPB2 Antibody - N-terminal region : Biotin
SKU
AVIARP57863_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABPB2

Key Reference: Crook,M.F., (2008) FASEB J. 22 (1), 225-235

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GA-binding protein subunit beta-1

Protein Size: 360

Purification: Affinity Purified

Subunit: beta-1
More Information
SKU AVIARP57863_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57863_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2553
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×