GAN Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAN

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Gigaxonin

Protein Size: 597

Purification: Affinity Purified

• SKU: AVIARP58470_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58470_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8139
• Host: Rabbit