GANAB Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: GANAB cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc2Man9GlcNAc2 oligosaccharide precursor of immature glycoproteins.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GANAB

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neutral alpha-glucosidase AB

Protein Size: 944

Purification: Affinity Purified

• SKU: AVIARP55868_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55868_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23193
• Host: Rabbit