GAPDH Antibody - middle region : FITC

GAPDH Antibody - middle region : FITC
SKU
AVIARP58579_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAPDH

Key Reference: Rinne,T., (2008) Hum. Mol. Genet. 17 (13), 1968-1977

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glyceraldehyde-3-phosphate dehydrogenase

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP58579_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58579_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2597
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×