GAPDH Antibody - middle region : HRP

GAPDH Antibody - middle region : HRP
SKU
AVIARP58578_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAPDH

Key Reference: Rinne,T., (2008) Hum. Mol. Genet. 17 (13), 1968-1977

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glyceraldehyde-3-phosphate dehydrogenase

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP58578_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58578_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2597
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×