GAS2L3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GAS2L3

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: SISIPKSCCRHEELHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGDKIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GAS2-like protein 3

Protein Size: 590

Purification: Affinity Purified

• SKU: AVIARP55729_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55729_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 283431
• Host: Rabbit