GBA3 Antibody - N-terminal region : HRP

GBA3 Antibody - N-terminal region : HRP
SKU
AVIARP57505_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GBA3, or cytosolic beta-glucosidase (EC 3.2.1.21), is a predominantly liver enzyme that efficiently hydrolyzes beta-D-glucoside and beta-D-galactoside, but not any known physiologic beta-glycoside, suggesting that it may be involved in detoxification of plant glycosides (de Graaf et al., 2001 [PubMed 11389701]). GBA3 also has significant neutral glycosylceramidase activity (EC 3.2.1.62), suggesting that it may be involved in a nonlysosomal catabolic pathway of glucosylceramide metabolism (Hayashi et al., 2007 [PubMed 17595169]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GBA3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LTHYRFSLSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytosolic beta-glucosidase

Protein Size: 469

Purification: Affinity Purified
More Information
SKU AVIARP57505_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57505_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57733
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×