GCLM Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GCLM

Key Reference: Jonsson,L.S., (2008) Int Arch Occup Environ Health 81 (7), 913-919

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamate--cysteine ligase regulatory subunit

Protein Size: 274

Purification: Affinity Purified

• SKU: AVIARP54624_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54624_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2730
• Host: Rabbit