GDF2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GDF2

Key Reference: David,L., (2008) Circ. Res. 102 (8), 914-922

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Growth/differentiation factor 2

Protein Size: 429

Purification: Affinity Purified

• SKU: AVIARP55339_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55339_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2658
• Host: Rabbit