GK Antibody - middle region : FITC

GK Antibody - middle region : FITC
SKU
AVIARP55955_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GK

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glycerol kinase Ensembl ENSP00000368229

Protein Size: 530

Purification: Affinity Purified
More Information
SKU AVIARP55955_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55955_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2710
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×