GLO1 Antibody - N-terminal region : HRP

GLO1 Antibody - N-terminal region : HRP
SKU
AVIARP54803_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLO1

Key Reference: Degaffe,G.H., (er) J. Diabetes Complicat. (2008) In press

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Lactoylglutathione lyase

Protein Size: 184

Purification: Affinity Purified
More Information
SKU AVIARP54803_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54803_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2739
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×