GLOD4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of GLOD4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLOD4

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glyoxalase domain-containing protein 4

Protein Size: 298

Purification: Affinity Purified

• SKU: AVIARP56828_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56828_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51031
• Host: Rabbit