GLRX Antibody - N-terminal region : Biotin

GLRX Antibody - N-terminal region : Biotin
SKU
AVIARP54626_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLRX

Key Reference: Prinarakis,E., (2008) EMBO J. 27 (6), 865-875

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-1

Protein Size: 106

Purification: Affinity Purified
More Information
SKU AVIARP54626_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54626_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2745
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×