Glrx1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Glrx1 catalyzes the deglutathionylation of protein-SS-glutathione mixed disulfides.

Molecular Weight: 11kDa

Peptide Sequence: Synthetic peptide located within the following region: QEILSQLPFKRGLLEFVDITATNNTNAIQDYLQQLTGARTVPRVFIGKDC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-1

Protein Size: 107

Purification: Affinity Purified

• SKU: AVIARP54625_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54625_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64045
• Host: Rabbit