GLRX5 Antibody - middle region : Biotin

GLRX5 Antibody - middle region : Biotin
SKU
AVIARP56908_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLRX5

Key Reference: Camaschella,C., (2007) Blood 110 (4), 1353-1358

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-related protein 5, mitochondrial

Protein Size: 157

Purification: Affinity Purified
More Information
SKU AVIARP56908_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56908_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51218
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×