GLUD2 Antibody - N-terminal region : Biotin

GLUD2 Antibody - N-terminal region : Biotin
SKU
AVIARP54828_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutamate dehydrogenase 2, mitochondrial

Protein Size: 558

Purification: Affinity Purified
More Information
SKU AVIARP54828_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54828_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2747
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×