GLUD2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GLUD2

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Glutamate dehydrogenase 2, mitochondrial

Protein Size: 558

Purification: Affinity Purified

• SKU: AVIARP54828_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54828_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2747
• Host: Rabbit