GNA12 Antibody - middle region : HRP

GNA12 Antibody - middle region : HRP
SKU
AVIARP54813_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNA12

Key Reference: Jeske,Y.W., (2008) Clin. Exp. Pharmacol. Physiol. 35 (4), 380-385

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein subunit alpha-12

Protein Size: 381

Purification: Affinity Purified

Subunit: alpha-12
More Information
SKU AVIARP54813_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54813_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2768
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×