GNAI2 Antibody - C-terminal region : Biotin

GNAI2 Antibody - C-terminal region : Biotin
SKU
AVIARP54632_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2

Key Reference: Bushfield,M., J. Cell. Sci. 120 (PT 13), 2171-2178 (2007)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(i) subunit alpha-2

Protein Size: 355

Purification: Affinity Purified

Subunit: alpha-2
More Information
SKU AVIARP54632_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54632_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2771
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×