GNAI3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(k) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha

• SKU: AVIARP58906_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58906_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2773
• Host: Rabbit
• Conjugate: Conjugated, FITC