GNAI3 Antibody - middle region : HRP

GNAI3 Antibody - middle region : HRP
SKU
AVIARP58906_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: GNAI3 is a guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K+ channels.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAI3

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(k) subunit alpha

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha
More Information
SKU AVIARP58906_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58906_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2773
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×