GNAL Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GNAL

Key Reference: Laurin,N., (2008) J Psychiatr Res 42 (2), 117-124

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(olf) subunit alpha

Protein Size: 458

Purification: Affinity Purified

Subunit: alpha

• SKU: AVIARP54634_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54634_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2774
• Host: Rabbit