GNAO1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Activated Goalpha interacted directly with PLZF, and enhanced its function as a transcriptional and cell growth suppressor. Goalpha might play a role in mediating extracellular signal-regulated kinase activation by G protein-coupled receptors in the brain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNAO1

Key Reference: Won,J.H., (2008) Cell. Signal. 20 (5), 884-891

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ31446 fis, clone NT2NE2000909, highly similar to Guanine nucleotide-binding protein G(o) subunit alpha 1 EMBL BAG51601.1

Protein Size: 354

Purification: Affinity Purified

Subunit: alpha

• SKU: AVIARP55425_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55425_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 2775
• Host: Rabbit