Gnaq Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gnaq may mediate cardiomyocyte growth and hypertrophy; overexpression may facilitate apoptosis by inhibiting the PI3K/phosphoinositide-dependent kinase-1/Akt cell survival signaling pathway.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: RRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha

Protein Size: 359

Purification: Affinity Purified

Subunit: alpha

• SKU: AVIARP54636_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54636_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81666
• Host: Rabbit