GNGT2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. GNGT2 is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones.Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. There is evidence for use of multiple polyadenylation sites by this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNGT2

Key Reference: DePuy,S.D., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (39), 14590-14595

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2

Protein Size: 69

Purification: Affinity Purified

Subunit: gamma-T2

• SKU: AVIARP55401_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55401_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2793
• Host: Rabbit